Structure of PDB 4u4z Chain m4

Receptor sequence
>4u4zm4 (length=137) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
STDSIVKASNWRLVEVGRVVLIKKGQSAGKLAAIVEIIDQKKVLIDGPKA
GVPRQAINLGQVVLTPLTFALPRGARTATVSKKWAAAAVCEKWAASSWAK
KIAQRERRAALTDFERFQVMVLRKQKRYTVKKALAKA
3D structure
PDB4u4z ?
Chainm4
Resolution3.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna m4 S2 I6 S10 W12 R13 K42 N59 P73 R74 A76 R77 T78 A79 T80 K83 K84 S98 W99 K102 R106 R109 M121 R124 K125 Q126 R128 Y129 K132 K133 S1 I5 S9 W11 R12 K41 N58 P72 R73 A75 R76 T77 A78 T79 K82 K83 S97 W98 K101 R105 R108 M120 R123 K124 Q125 R127 Y128 K131 K132
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0000470 maturation of LSU-rRNA
GO:0002181 cytoplasmic translation
GO:0006412 translation
GO:0016236 macroautophagy
GO:0042273 ribosomal large subunit biogenesis
Cellular Component
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:0032991 protein-containing complex
GO:0043232 intracellular non-membrane-bounded organelle
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4u4z, PDBe:4u4z, PDBj:4u4z
PDBsum4u4z
PubMed25209664
UniProtP36105|RL14A_YEAST Large ribosomal subunit protein eL14A (Gene Name=RPL14A)

[Back to BioLiP]