Structure of PDB 4u4n Chain m3

Receptor sequence

>4u4nm3 (length=194) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]

AISKNLPILKNHFRKHWQERVKVHFDQAGKKVSRRNARATRAAKIAPRPL
DLLRPVVRAPTVKYNRKVRAGRGFTLAEVKAAGLTAAYARTIGIAVDHRR
QNRNQEIFDANVQRLKEYQSKIIVFPRNGKAPEAEQVLSAAATFPIAQPA
TDVEARAVQDNGESAFRTLRLARSEKKFRGIREKRAREKAEAEA

3D structure

PDB

4u4n ?

Chain

Resolution

3.1 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	m3	I3 S4 K5 L7 P8 L10 K11 N12 H13 F14 R15 K16 H17 W18 Q28 A29 K31 K32 R35 R36 R39 R42 K45 R55 V58 R59 P61 T62 Y65 N66 R70 R73 R91 D98 H99 R100 R101 R104 R128 R168 R171 R174 S175 K178 F179 R180 G181 R183 K185 R186	I2 S3 K4 L6 P7 L9 K10 N11 H12 F13 R14 K15 H16 W17 Q27 A28 K30 K31 R34 R35 R38 R41 K44 R54 V57 R58 P60 T61 Y64 N65 R69 R72 R90 D97 H98 R99 R100 R103 R127 R167 R170 R173 S174 K177 F178 R179 G180 R182 K184 R185
BS02	rna	m3	F26 D27 G30 S34	F25 D26 G29 S33

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:4u4n, PDBe:4u4n, PDBj:4u4n
PDBsum	4u4n
PubMed	25209664
UniProt	Q12690\|RL13A_YEAST Large ribosomal subunit protein eL13A (Gene Name=RPL13A)

[Back to BioLiP]