Structure of PDB 4yuu Chain m2

Receptor sequence
>4yuum2 (length=40) Species: 2771 (Cyanidium caldarium) [Search protein sequence]
MVVQEGGYLAVLLGVLFPVAFLIILYIQSEARNAGMREAA
3D structure
PDB4yuu Novel Features of Eukaryotic Photosystem II Revealed by Its Crystal Structure Analysis from a Red Alga
Chainm2
Resolution2.77 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 peptide m2 V3 Y8 V3 Y8
BS02 CLA m2 P18 F21 P18 F21
Gene Ontology
--> -->
 
 
UnboundLocalError
Python 3.6.8: /usr/bin/python3
Wed Apr 9 21:00:25 2025

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '4yuu', asym_id = 'm2', title = 'Novel Features of Eukaryotic Photosystem II Reve...by Its Crystal Structure Analysis from a Red Alga'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='4yuu', asym_id='m2', title='Novel Features of Eukaryotic Photosystem II Reve...by Its Crystal Structure Analysis from a Red Alga')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0009523,0015979,0016020,0019684', uniprot = '', pdbid = '4yuu', asym_id = 'm2'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0009523,0015979,0016020,0019684', uniprot='', pdbid='4yuu', asym_id='m2')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>