Structure of PDB 7r81 Chain m1

Receptor sequence
>7r81m1 (length=73) Species: 5141 (Neurospora crassa) [Search protein sequence]
PQEIGDIKKFIEICRRKDASAARIKKNKATQQIKFKVRCQKYLYTLVLKD
SDKAEKLKASLPPSLTIADVAKR
3D structure
PDB7r81 Structure of the translating Neurospora ribosome arrested by cycloheximide
Chainm1
Resolution2.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna m1 P2 Q3 E4 R17 D19 R24 K26 K35 K37 R39 Q41 K42 Y43 L44 T46 K73 R74 P1 Q2 E3 R16 D18 R23 K25 K34 K36 R38 Q40 K41 Y42 L43 T45 K72 R73
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
GO:0022618 protein-RNA complex assembly
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7r81, PDBe:7r81, PDBj:7r81
PDBsum7r81
PubMed34815343
UniProtQ9C2B9|RL38_NEUCR Large ribosomal subunit protein eL38 (Gene Name=rpl-38)

[Back to BioLiP]