Structure of PDB 7oya Chain m1

Receptor sequence
>7oyam1 (length=50) Species: 7955 (Danio rerio) [Search protein sequence]
IEPSLRQLAQKYNCEKMICRKCYARLHPRAVNCRKKKCGHTNNLRPKKKL
3D structure
PDB7oya A molecular network of conserved factors keeps ribosomes dormant in the egg.
Chainm1
Resolution3.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna m1 K93 I95 R97 Y100 R102 H104 R106 N109 R111 K112 K113 K114 G116 H117 N119 R122 K124 K125 K16 I18 R20 Y23 R25 H27 R29 N32 R34 K35 K36 K37 G39 H40 N42 R45 K47 K48
BS02 ZN m1 C96 C110 C115 C19 C33 C38
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0031386 protein tag activity
GO:0031625 ubiquitin protein ligase binding
Biological Process
GO:0006412 translation
GO:0016567 protein ubiquitination
GO:0019941 modification-dependent protein catabolic process
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7oya, PDBe:7oya, PDBj:7oya
PDBsum7oya
PubMed36653451
UniProtQ3B7P7

[Back to BioLiP]