Structure of PDB 5dgv Chain m0

Receptor sequence

>5dgvm0 (length=213) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]

ARRPARCYRYQKNKPYPKSRYNRAVPDSKIRIYDLGKKKATVDEFPLCVH
LVSNELEQLSSEALEAARICANKYMTTVSGRDAFHLRVRVHPFHVLRINK
MLLQQGMRGAWGKPHGLAARVDIGQIIFSVRTKDSNKDVVVEGLRRARYK
FPGQQKIILSKKWGFTNLDRPEYLKKREAGEVKDDGAFVKFLSKKGSLEN
NIREFPEYFAAQA

3D structure

PDB

5dgv Coping with proline stalling: structural basis of hypusine-induced protein synthesis by the eukaryotic ribosome

Chain

Resolution

3.1 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	m0	R3 R4 R7 C8 K13 N14 K15 Y22 E63 A64 A67 R90 H92 F94 R98 N100 M115 R116 A118 W119 R154 Y157 K158 P160 D193 G194 A195 K198	R2 R3 R6 C7 K12 N13 K14 Y21 E62 A63 A66 R89 H91 F93 R97 N99 M107 R108 A110 W111 R146 Y149 K150 P152 D185 G186 A187 K190
BS02	rna	m0	Y11 L57 S201 K202 K203 G204 L206	Y10 L56 S193 K194 K195 G196 L198

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0005515	protein binding

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0002181	cytoplasmic translation
GO:0006412	translation
GO:0006415	translational termination

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5dgv, PDBe:5dgv, PDBj:5dgv
PDBsum	5dgv
PubMed
UniProt	P41805\|RL10_YEAST Large ribosomal subunit protein uL16 (Gene Name=RPL10)

[Back to BioLiP]