Structure of PDB 5dc3 Chain m0

Receptor sequence

>5dc3m0 (length=213) Species: 559292 (Saccharomyces cerevisiae S288C)

ARRPARCYRYQKNKPYPKSRYNRAVPDSKIRIYDLGKKKATVDEFPLCVH
LVSNELEQLSSEALEAARICANKYMTTVSGRDAFHLRVRVHPFHVLRINK
MLLQQGMRGAWGKPHGLAARVDIGQIIFSVRTKDSNKDVVVEGLRRARYK
FPGQQKIILSKKWGFTNLDRPEYLKKREAGEVKDDGAFVKFLSKKGSLEN
NIREFPEYFAAQA

3D structure

• PDB: 5dc3 Crystal Structure of Hypusine-Containing Translation Factor eIF5A Bound to a Rotated Eukaryotic Ribosome.
• Chain: m0
• Resolution: 3.25 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	m0	R3 R4 A6 R7 K13 N14 K15 P16 Y22 D35 K39 E63 A64 A67 K74 R90 H92 F94 R98 G114 M115 R116 G117 A118 W119 R154 Y157 K158 P160 D193 G194 A195 F196 K198	R2 R3 A5 R6 K12 N13 K14 P15 Y21 D34 K38 E62 A63 A66 K73 R89 H91 F93 R97 G106 M107 R108 G109 A110 W111 R146 Y149 K150 P152 D185 G186 A187 F188 K190
BS02	rna	m0	Y11 L57 K202 K203 G204 L206	Y10 L56 K194 K195 G196 L198

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0005515 protein binding

Biological Process

• GO:0000027 ribosomal large subunit assembly
• GO:0002181 cytoplasmic translation
• GO:0006412 translation
• GO:0006415 translational termination

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:5dc3, PDBe:5dc3, PDBj:5dc3
• PDBsum: 5dc3
• PubMed: 27196944
• UniProt: P41805|RL10_YEAST Large ribosomal subunit protein uL16 (Gene Name=RPL10)