Structure of PDB 8xjv Chain m

Receptor sequence
>8xjvm (length=98) Species: 8355 (Xenopus laevis) [Search protein sequence]
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSS
AVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
3D structure
PDB8xjv Structural basis for linker histone H5-nucleosome binding and chromatin fiber compaction.
Chainm
Resolution3.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna m R351 P354 G355 V357 A358 R374 K375 L376 R380 R3 P6 G7 V9 A10 R26 K27 L28 R32
BS02 dna m H350 R351 Y352 P354 R360 R374 R383 Q396 R427 V428 T429 H2 R3 Y4 P6 R12 R26 R35 Q48 R79 V80 T81
External links