Structure of PDB 8v83 Chain m

Receptor sequence
>8v83m (length=211) Species: 1247190 (Saccharomyces cerevisiae BY4741) [Search protein sequence]
YSKYADGSDRIIKPEINPVYDSDDSDAETQNTIGNIPLSAYDEMPHIGYD
INGKRIMRPNPYEPLIDWFTRHEEVMPLTAVPEPKRRFVPSKNEAKRVMK
IVRAIREGRIIPPKKLKEMKEKEKIENYQYDLWGHLRAPKLPPPTNEESY
NPPEEYLLSPEEKEAWENTEYSERERNFIPQKYSALRKVPGYGESIRERF
ERSLDLYLAPR
3D structure
PDB8v83 The DEAD-box ATPase Dbp10/DDX54 initiates peptidyl transferase center formation during 60S ribosome biogenesis.
Chainm
Resolution2.53 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna m A258 V259 P260 P262 K263 R264 R265 F266 V267 P268 S269 K270 E272 K274 R275 M277 R281 R287 I288 A80 V81 P82 P84 K85 R86 R87 F88 V89 P90 S91 K92 E94 K96 R97 M99 R103 R109 I110
Gene Ontology
Molecular Function
GO:0003674 molecular_function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0043021 ribonucleoprotein complex binding
GO:0070180 large ribosomal subunit rRNA binding
Biological Process
GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0000466 maturation of 5.8S rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0006364 rRNA processing
GO:0042254 ribosome biogenesis
GO:0042273 ribosomal large subunit biogenesis
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005730 nucleolus
GO:0030687 preribosome, large subunit precursor
GO:0070545 PeBoW complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8v83, PDBe:8v83, PDBj:8v83
PDBsum8v83
PubMed38632236
UniProtQ04660|ERB1_YEAST Ribosome biogenesis protein ERB1 (Gene Name=ERB1)

[Back to BioLiP]