Structure of PDB 8q5i Chain m

Receptor sequence

>8q5im (length=292) Species: 5476 (Candida albicans) [Search protein sequence]

MQKEFRTSAYHSRFQTPFRRRQEGKTDYYQRKRLVTQHKAKYNSPKYRLV
VRFTNKDIIAQIVSAHITGDVVFTAAYAHELPRYGIKYGLTNWSAAYAVG
LLVARRALQKLGLDETYTGVEEVEGEFELTEAVEDGPRPFKVFLDIGLQR
TTTGARVFGVLKGASDGGLYVPHSPNRFPGWDIEAEELDAELLRKYIFGG
HVAEYMEELLDDDEEKYKSIFKNYIEEEIESEDVEEIYANAHEAIRADPS
FKPTEKKFTKEQYKAESKKYRQQKLTRAERQAKVAKKIAEFK

3D structure

PDB

8q5i Structural characterization of cephaeline binding to the eukaryotic ribosome using Cryo-Electron Microscopy

Chain

Resolution

2.45 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	m	M3 Q4 K5 E6 F7 R8 Y12 R15 F16 Q17 R23 G26 T28 D29 Y31 R35 L36 K43 Y44 K48 L113 P139 R140 P141 F142 F145 I148 L150 T153 F160 H175 S176 N178 R179	M1 Q2 K3 E4 F5 R6 Y10 R13 F14 Q15 R21 G24 T26 D27 Y29 R33 L34 K41 Y42 K46 L111 P137 R138 P139 F140 F143 I146 L148 T151 F158 H173 S174 N176 R177
BS02	rna	m	R8 S10 H13 S14 F16 T18 F20 R21 R22 Q24 T28 Y30 R33 V52 R54 T56 N57 K58 Q63 I69 T70 G71 D72 V74 G91 N94 R152 T154 T155 G156 A157 R158 Y198 H203 Y207 K218 S221 I222 N225 F253 P255 T256 K258 F260 K262 Y265 K266 E268 S269 Y272 R273 Q274 K276 L277 R279 K289	R6 S8 H11 S12 F14 T16 F18 R19 R20 Q22 T26 Y28 R31 V50 R52 T54 N55 K56 Q61 I67 T68 G69 D70 V72 G89 N92 R150 T152 T153 G154 A155 R156 Y196 H201 Y205 K216 S219 I220 N223 F251 P253 T254 K256 F258 K260 Y263 K264 E266 S267 Y270 R271 Q272 K274 L275 R277 K287

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0008097	5S rRNA binding

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8q5i, PDBe:8q5i, PDBj:8q5i
PDBsum	8q5i
PubMed
UniProt	Q5AGZ7\|RL5_CANAL Large ribosomal subunit protein uL18 (Gene Name=RPL5)

[Back to BioLiP]