Structure of PDB 8p2h Chain m

Receptor sequence

>8p2hm (length=135) Species: 93061 (Staphylococcus aureus subsp. aureus NCTC 8325)

PTINQLVRKPRQSKIKKSDSPALNKGFNSKKKKFTDLNSPQKRGVCTRVG
TMTPKKPNSALRKYARVRLSNNIEINAYIPGIGHNLQEHSVVLVRGGRVK
DLPGVRYHIVRGALDTSGVDGRRQGRSLYGTKKPK

3D structure

• PDB: 8p2h Staphylococcus aureus 70S ribosome with elongation factor G locked with fusidic acid with a tRNA in pe/E chimeric hybrid state
• Chain: m
• Resolution: 2.49 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	m	P2 T3 N5 Q6 R9 R12 Q13 S14 K15 K18 S19 N29 K31 K32 L38 N39 S40 P41 Q42 K43 R44 K57 N59 S60 A61 L62 R63 K64 S71 Y79 P81 G82 R96 G97 K101 D102 R107 G113 R123 R124 Q125 G126 R127 S128 L129 G131 T132 K133 K134	P1 T2 N4 Q5 R8 R11 Q12 S13 K14 K17 S18 N28 K30 K31 L37 N38 S39 P40 Q41 K42 R43 K56 N58 S59 A60 L61 R62 K63 S70 Y78 P80 G81 R95 G96 K100 D101 R106 G112 R122 R123 Q124 G125 R126 S127 L128 G130 T131 K132 K133

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8p2h, PDBe:8p2h, PDBj:8p2h
• PDBsum: 8p2h
• PubMed: 38902339
• UniProt: P0A0H0|RS12_STAA8 Small ribosomal subunit protein uS12 (Gene Name=rpsL)