Structure of PDB 8p16 Chain m

Receptor sequence
>8p16m (length=129) Species: 562 (Escherichia coli) [Search protein sequence]
SMQDPIADMLTRIRNGQAANKAAVTMPSSKLKVAIANVLKEEGFIEDFKV
EGDTKPELELTLKYFQGKAVVESIQRVSRPGLRIYKRKDELPKVMAGLGI
AVVSTSKGVMTDRAARQAGLGGEIICYVA
3D structure
PDB8p16 The compensatory mechanism of a naturally evolved E167K RF2 counteracting the loss of RF1 in bacteria
Chainm
Resolution2.77 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna m S2 Q4 P6 D9 T12 R13 R15 N16 A20 S30 K31 K56 R80 P81 G82 Y86 R88 K89 S105 T106 S107 G120 G122 S1 Q3 P5 D8 T11 R12 R14 N15 A19 S29 K30 K55 R79 P80 G81 Y85 R87 K88 S104 T105 S106 G119 G121
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0002181 cytoplasmic translation
GO:0006412 translation
GO:0006417 regulation of translation
GO:0043488 regulation of mRNA stability
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8p16, PDBe:8p16, PDBj:8p16
PDBsum8p16
PubMed
UniProtP0A7W7|RS8_ECOLI Small ribosomal subunit protein uS8 (Gene Name=rpsH)

[Back to BioLiP]