Structure of PDB 8g7q Chain m

Receptor sequence
>8g7qm (length=115) Species: 562 (Escherichia coli) [Search protein sequence]
ARIAGINIPDHKHAVIALTSIYGVGKTRSKAILAAAGIAEDVKISELSEG
QIDTLRDEVAKFVVEGDLRREISMSIKRLMDLGCYRGLRHRRGLPVRGQR
TKTNARTRKGPRKPI
3D structure
PDB8g7q Structures of the ribosome bound to EF-Tu-isoleucine tRNA elucidate the mechanism of AUG avoidance
Chainm
Resolution3.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna m I17 Y23 G24 G26 R29 R87 H91 V97 R98 Q100 R101 T102 K103 T104 N105 A106 R107 T108 K110 R113 K114 I116 I16 Y22 G23 G25 R28 R86 H90 V96 R97 Q99 R100 T101 K102 T103 N104 A105 R106 T107 K109 R112 K113 I115
BS02 rna m M81 R92 R93 M80 R91 R92
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005829 cytosol
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8g7q, PDBe:8g7q, PDBj:8g7q
PDBsum8g7q
PubMed38538914
UniProtA0A7U9IV78

[Back to BioLiP]