Structure of PDB 8f4f Chain m

Receptor sequence
>8f4fm (length=32) Species: 197221 (Thermosynechococcus vestitus BP-1) [Search protein sequence]
MEVNQLGLIATALFVLVPSVFLIILYVQTESQ
3D structure
PDB8f4f Structural evidence for intermediates during O 2 formation in photosystem II.
Chainm
Resolution2.03 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLA m F21 L25 F21 L25
Gene Ontology
Biological Process
GO:0015979 photosynthesis
GO:0019684 photosynthesis, light reaction
Cellular Component
GO:0005737 cytoplasm
GO:0009523 photosystem II
GO:0009579 thylakoid
GO:0016020 membrane
GO:0031676 plasma membrane-derived thylakoid membrane
GO:0042651 thylakoid membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8f4f, PDBe:8f4f, PDBj:8f4f
PDBsum8f4f
PubMed37138085
UniProtQ8DHA7|PSBM_THEVB Photosystem II reaction center protein M (Gene Name=psbM)

[Back to BioLiP]