Structure of PDB 8ev3 Chain m

Receptor sequence
>8ev3m (length=75) Species: 4896 (Schizosaccharomyces pombe) [Search protein sequence]
EIDAGYSSDSSTEDPYPDYDDFFTNTVRETPLSSAPEPKRRFAPSKHEQK
RILQLAYAIRKGRILTSEQRAERER
3D structure
PDB8ev3 Chromatin localization of nucleophosmin organizes ribosome biogenesis.
Chainm
Resolution3.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna m A218 P219 P221 K222 R223 R224 A226 P227 S228 K229 H230 E231 Q232 L236 Y240 K244 R246 I247 A35 P36 P38 K39 R40 R41 A43 P44 S45 K46 H47 E48 Q49 L53 Y57 K61 R63 I64
Gene Ontology
Molecular Function
GO:0003674 molecular_function
GO:0043021 ribonucleoprotein complex binding
Biological Process
GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0000466 maturation of 5.8S rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0006364 rRNA processing
GO:0042254 ribosome biogenesis
GO:0042273 ribosomal large subunit biogenesis
GO:1902626 assembly of large subunit precursor of preribosome
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005730 nucleolus
GO:0030687 preribosome, large subunit precursor
GO:0070545 PeBoW complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8ev3, PDBe:8ev3, PDBj:8ev3
PDBsum8ev3
PubMed36423630
UniProtO74399|ERB1_SCHPO Ribosome biogenesis protein erb1 (Gene Name=erb1)

[Back to BioLiP]