Structure of PDB 8c3a Chain m

Receptor sequence

>8c3am (length=296) Species: 5476 (Candida albicans)

MQKEFRTSAYHSRFQTPFRRRQEGKTDYYQRKRLVTQHKAKYNSPKYRLV
VRFTNKDIIAQIVSAHITGDVVFTAAYAHELPRYGIKYGLTNWSAAYAVG
LLVARRALQKLGLDETYTGVEEVEGEFELTEAVEDGPRPFKVFLDIGLQR
TTTGARVFGVLKGASDGGLYVPHSPNRFPGWDIEAEELDAELLRKYIFGG
HVAEYMEELLDDDEEKYKSIFKNYIEEEIESEDVEEIYANAHEAIRADPS
FKPTEKKFTKEQYKAESKKYRQQKLTRAERQAKVAKKIAEFKAQQE

3D structure

• PDB: 8c3a New crystal system to promote screening for new eukaryotic inhibitors
• Chain: m
• Resolution: 3.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	m	M3 Q4 K5 E6 R8 A11 Y12 R15 F16 Q17 R23 T28 R35 L36 K43 Y44 S46 K48 Y49 L113 P139 R140 P141 F142 F145 I148 L150 T153 P174 H175 S176 N178 R179	M1 Q2 K3 E4 R6 A9 Y10 R13 F14 Q15 R21 T26 R33 L34 K41 Y42 S44 K46 Y47 L111 P137 R138 P139 F140 F143 I146 L148 T151 P172 H173 S174 N176 R177
BS02	rna	m	S10 H13 S14 F16 T18 F20 R21 R22 Q24 T28 Y30 R33 R50 V52 R54 T56 N57 Q63 I69 T70 G71 D72 V73 V74 Y79 G91 N94 W95 R152 T154 T155 G156 A157 R158 Y198 H203 Y207 K218 S221 I222 N225 F253 P255 T256 F260 K262 Y265 K266 E268 S269 Y272 Q274 K276 L277 R282 K285 K289	S8 H11 S12 F14 T16 F18 R19 R20 Q22 T26 Y28 R31 R48 V50 R52 T54 N55 Q61 I67 T68 G69 D70 V71 V72 Y77 G89 N92 W93 R150 T152 T153 G154 A155 R156 Y196 H201 Y205 K216 S219 I220 N223 F251 P253 T254 F258 K260 Y263 K264 E266 S267 Y270 Q272 K274 L275 R280 K283 K287

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0008097 5S rRNA binding

Biological Process

• GO:0000027 ribosomal large subunit assembly
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8c3a, PDBe:8c3a, PDBj:8c3a
• PDBsum: 8c3a
• UniProt: G1UAA6