Structure of PDB 8azw Chain m

Receptor sequence

>8azwm (length=126) Species: 4097 (Nicotiana tabacum) [Search protein sequence]

MKYNPRVSSSRRKSRKAHFTAPSSVRRVLMSAPLSSDLRTKYNVRSMPVR
KDDEVQVVRGTYKGREGKVVQVYRKKWVIHIERITREKVNGSTVNVGIHP
SKVVVTKLRLDKDRKSLLDRKAKGRA

3D structure

PDB

8azw Structure of the actively translating plant 80S ribosome at 2.2 angstrom resolution.

Chain

Resolution

2.14 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	m	M1 K2 Y3 N4 P5 S8 S9 R11 K13 S14 R15 V28 L29 S31 P33 R45 S46 R59 G60 T61 R86 K88 V89 H99 S101 K102 R120 K121 G124 R125	M1 K2 Y3 N4 P5 S8 S9 R11 K13 S14 R15 V28 L29 S31 P33 R45 S46 R59 G60 T61 R86 K88 V89 H99 S101 K102 R120 K121 G124 R125
BS02	rna	m	R11 R12 R15 K16 F19 P22 S23 S24 R27 R50 K51 Q71 V72 Y73 R74 K75 L110 D111 K112 D113 K115	R11 R12 R15 K16 F19 P22 S23 S24 R27 R50 K51 Q71 V72 Y73 R74 K75 L110 D111 K112 D113 K115

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation
GO:0042273	ribosomal large subunit biogenesis

	Cellular Component
GO:0005840	ribosome
GO:0015934	large ribosomal subunit
GO:0022625	cytosolic large ribosomal subunit

External links