Structure of PDB 8asp Chain m

Receptor sequence
>8aspm (length=31) Species: 1148 (Synechocystis sp. PCC 6803) [Search protein sequence]
MALSDTQILAALVVALLPAFLAFRLSTELYK
3D structure
PDB8asp The Ycf48 accessory factor occupies the site of the oxygen-evolving manganese cluster during photosystem II biogenesis.
Chainm
Resolution2.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLA m A22 F23 S26 L29 Y30 A22 F23 S26 L29 Y30
BS02 ECH m A19 A22 A19 A22
Gene Ontology
Cellular Component
GO:0009522 photosystem I
GO:0009579 thylakoid
GO:0016020 membrane
GO:0031676 plasma membrane-derived thylakoid membrane
GO:0042651 thylakoid membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8asp, PDBe:8asp, PDBj:8asp
PDBsum8asp
PubMed37542031
UniProtP72986|PSAM_SYNY3 Photosystem I reaction center subunit XII (Gene Name=psaM)

[Back to BioLiP]