Structure of PDB 7w31 Chain m

Receptor sequence

>7w31m (length=129) Species: 9823 (Sus scrofa)

MTMYIAFILSTIFVIGFVGFSSKPSPIYGGLGLIVSGGVGCGIVLNFGGS
FLGLMVFLIYLGGMLVVFGYTTAMATGDWVIYDTGDSGFFSEEAMGIAAL
YSYGTWLVIVTGWSLLIGVVVIMEITRGN

3D structure

• PDB: 7w31 The coupling mechanism of mammalian mitochondrial complex I.
• Chain: m
• Resolution: 3.1 Å

Enzymatic activity

• Enzyme Commision number: 7.1.1.2: NADH:ubiquinone reductase (H(+)-translocating).

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	PLX	m	W152 I155	W106 I109

Gene Ontology

Molecular Function

• GO:0008137 NADH dehydrogenase (ubiquinone) activity

Biological Process

• GO:0006120 mitochondrial electron transport, NADH to ubiquinone
• GO:0032981 mitochondrial respiratory chain complex I assembly
• GO:1902600 proton transmembrane transport

Cellular Component

• GO:0005739 mitochondrion
• GO:0005743 mitochondrial inner membrane

External links

• PDB: RCSB:7w31, PDBe:7w31, PDBj:7w31
• PDBsum: 7w31
• PubMed: 35145322
• UniProt: O79882|NU6M_PIG NADH-ubiquinone oxidoreductase chain 6 (Gene Name=MT-ND6)