Structure of PDB 7vy2 Chain m

Receptor sequence

>7vy2m (length=306) Species: 39723 (Cereibacter sphaeroides f. sp. denitrificans)

AEYQNIFTQVQVRGPADLGMTEDVNLANRSGVGPFSTLLGWFGNAQLGPI
YLGSLGVLSLFSGLMWFFTIGIWFWYQAGWNPAVFLRDLFFFSLEPPAPE
YGLSFAAPLKEGGLWLIASFFMFVAVWSWWGRTYLRAQALGMGKHTAWAF
LSAIWLWMVLGFIRPILMGSWSEAVPYGIFSHLDWTNNFSLVHGNLFYNP
FHGLSIAFLYGSALLFAMHGATILAVSRFGGERELEQIADRGTAAERAAL
FWRWTMGFNATMEGIHRWAIWMAVLVTLTGGIGILLSGTVVDNWYVWGQN
HGMAPL

3D structure

• PDB: 7vy2 Asymmetric structure of the native Rhodobacter sphaeroides dimeric LH1-RC complex.
• Chain: m
• Resolution: 2.75 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	BPH	m	Y210 L214 M218 M256	Y210 L214 M218 M256
BS02	U10	m	L89 F90	L89 F90
BS03	BCL	m	G203 I206 A207 Y210 G211 L214	G203 I206 A207 Y210 G211 L214
BS04	BCL	m	I179 H182 L183	I179 H182 L183
BS05	BCL	m	V126 A153 L156 W157 L160 T186 N187 F189 S190 L196 F197 H202 S205 I206 Y210 G280 I284	V126 A153 L156 W157 L160 T186 N187 F189 S190 L196 F197 H202 S205 I206 Y210 G280 I284
BS06	BPH	m	G63 L64 W129 A149 F150 A153 T277	G63 L64 W129 A149 F150 A153 T277
BS07	FE	m	H219 E234 H266	H219 E234 H266
BS08	U10	m	M218 H219 T222 A249 W252 M256 F258 N259 A260 I265 W268	M218 H219 T222 A249 W252 M256 F258 N259 A260 I265 W268
BS09	SPO	m	F67 I70 G71 F74 W75 F105 W115 L116 S119 F120 M122 W157 G161 F162 Y177	F67 I70 G71 F74 W75 F105 W115 L116 S119 F120 M122 W157 G161 F162 Y177

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Mon Nov 25 19:16:27 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '7vy2', asym_id = 'm', title = 'Asymmetric structure of the native Rhodobacter sphaeroides dimeric LH1-RC complex.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='7vy2', asym_id='m', title='Asymmetric structure of the native Rhodobacter sphaeroides dimeric LH1-RC complex.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0009772,0019684,0030077,0045156', uniprot = '', pdbid = '7vy2', asym_id = 'm'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0009772,0019684,0030077,0045156', uniprot='', pdbid='7vy2', asym_id='m')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>