Structure of PDB 7r6q Chain m

Receptor sequence
>7r6qm (length=180) Species: 1247190 (Saccharomyces cerevisiae BY4741) [Search protein sequence]
SINPYEPLIDWFTRHEEVMPLTAVPEPKRRFVPSKNEAKRVMKIVRAIRE
GRIIPPKKLKEMKEKEKIENYQYDLWGDSTETNDHVMHLRAPKLPPPTNE
ESYNPPEEYLLSPEEKEAWENTEYSERERNFIPQKYSALRKVPGYGESIR
ERFERSLDLYLAPRVRKNKLNIDPNSLIPE
3D structure
PDB7r6q Sequence-specific remodeling of a topologically complex RNP substrate by Spb4.
Chainm
Resolution2.98 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna m A258 V259 K263 R264 R265 F266 V267 P268 S269 K270 E272 M277 R284 R287 L392 Y395 K404 L405 N406 I407 A23 V24 K28 R29 R30 F31 V32 P33 S34 K35 E37 M42 R49 R52 L157 Y160 K169 L170 N171 I172
BS02 rna m V321 M322 V86 M87
Gene Ontology
Molecular Function
GO:0003674 molecular_function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0043021 ribonucleoprotein complex binding
GO:0070180 large ribosomal subunit rRNA binding
Biological Process
GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0000466 maturation of 5.8S rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0006364 rRNA processing
GO:0042254 ribosome biogenesis
GO:0042273 ribosomal large subunit biogenesis
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005730 nucleolus
GO:0030687 preribosome, large subunit precursor
GO:0070545 PeBoW complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7r6q, PDBe:7r6q, PDBj:7r6q
PDBsum7r6q
PubMed36482249
UniProtQ04660|ERB1_YEAST Ribosome biogenesis protein ERB1 (Gene Name=ERB1)

[Back to BioLiP]