Structure of PDB 7qiz Chain m

Receptor sequence
>7qizm (length=68) Species: 4081 (Solanum lycopersicum) [Search protein sequence]
PKQIHEIKDFLLTARRKDARTVKIKKNKDMVKFKVRCSKYLYTLCVSDFE
KADKLKQSLPPGLSVQDL
3D structure
PDB7qiz Specific features and methylation sites of a plant ribosome
Chainm
Resolution2.38 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna m P2 K3 Q4 R17 D19 K26 N28 K33 K35 R37 S39 K40 Y41 L42 T44 L69 P1 K2 Q3 R16 D18 K25 N27 K32 K34 R36 S38 K39 Y40 L41 T43 L68
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
GO:0022618 protein-RNA complex assembly
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7qiz, PDBe:7qiz, PDBj:7qiz
PDBsum7qiz
PubMed35643637
UniProtP46291|RL38_SOLLC Large ribosomal subunit protein eL38 (Gene Name=RPL38)

[Back to BioLiP]