Structure of PDB 7pqd Chain m

Receptor sequence

>7pqdm (length=307) Species: 272943 (Cereibacter sphaeroides 2.4.1) [Search protein sequence]

AEYQNIFSQVQVRGPADLGMTEDVNLANRSGVGPFSTLLGWFGNAQLGPI
YLGSLGVLSLFSGLMWFFTIGIWFWYQAGWNPAVFLRDLFFFSLEPPAPE
YGLSFAAPLKEGGLWLIASFFMFVAVWSWWGRTYLRAQALGMGKHTAWAF
LSAIWLWMVLGFIRPILMGSWSEAVPYGIFSHLDWTNNFSLVHGNLFYNP
FHGLSIAFLYGSALLFAMHGATILAVSRFGGERELEQIADRGTAAERAAL
FWRWTMGFNATMEGIHRWAIWMAVLVTLTGGIGILLSGTVVDNWYVWGQN
HGMAPLN

3D structure

PDB

7pqd Cryo-EM structure of the dimeric Rhodobacter sphaeroides RC-LH1 core complex at 2.9 angstrom : the structural basis for dimerisation.

Chain

Resolution

2.9 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	BPH	m	Y210 L214 M218 W252	Y210 L214 M218 W252
BS02	BCL	m	G203 I206 A207 Y210 G211 L214	G203 I206 A207 Y210 G211 L214
BS03	BPH	m	G63 W129 A149 F150 A153 T277	G63 W129 A149 F150 A153 T277
BS04	U10	m	M218 H219 T222 A248 A249 W252 M256 F258 N259 A260 I265 W268	M218 H219 T222 A248 A249 W252 M256 F258 N259 A260 I265 W268
BS05	BCL	m	L156 W157 T186 N187 F189 L196 F197 H202 S205 I206 L209 Y210 G280 I284	L156 W157 T186 N187 F189 L196 F197 H202 S205 I206 L209 Y210 G280 I284
BS06	BCL	m	I179 H182 L183	I179 H182 L183
BS07	SP2	m	F67 I70 G71 F74 W75 F105 W115 S119 M122 W157 G161 W171 V175 Y177 H182	F67 I70 G71 F74 W75 F105 W115 S119 M122 W157 G161 W171 V175 Y177 H182
BS08	FE	m	H219 E234 H266	H219 E234 H266

Gene Ontology

	Molecular Function
GO:0042314	bacteriochlorophyll binding
GO:0045156	electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
GO:0046872	metal ion binding

	Biological Process
GO:0009772	photosynthetic electron transport in photosystem II
GO:0015979	photosynthesis
GO:0019684	photosynthesis, light reaction

	Cellular Component
GO:0016020	membrane
GO:0030077	plasma membrane light-harvesting complex
GO:0042717	plasma membrane-derived chromatophore membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7pqd, PDBe:7pqd, PDBj:7pqd
PDBsum	7pqd
PubMed	34622934
UniProt	Q3J1A6\|RCEM_CERS4 Reaction center protein M chain (Gene Name=pufM)

[Back to BioLiP]