Structure of PDB 7pkt Chain m

Receptor sequence

>7pktm (length=177) Species: 3055 (Chlamydomonas reinhardtii) [Search protein sequence]

ARVRVRLGDWNRLNRKWQHRVSMMKTMVTQLLEKERIRTTLAKAKTLQRY
ADKVITLGKQGTREAWSEARGIVRTDRELHKLFTQVALRYRERPGGFTRL
VRAGWRERDAAPVAFVELVDRPGELRPANPALQRPNPLSVQAWIRQQLGQ
PAREPSPLLPPSVQQYLREENRIQQGR

3D structure

PDB

7pkt How to build a ribosome from RNA fragments in Chlamydomonas mitochondria.

Chain

Resolution

3.0 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	m	H20 S23 T27 M28 Q31 K35 R39 T40 K44 R75 F116	H19 S22 T26 M27 Q30 K34 R38 T39 K43 R74 F115
BS02	rna	m	A2 R3 R5 V6 R7 N12 R13 L14 N15 K44 D110	A1 R2 R4 V5 R6 N11 R12 L13 N14 K43 D109
BS03	rna	m	R3 R5 R7 L8 W11 N12 W18 Q19 R21 V22 L42 A43 K46 R50 Y51 D53 S68 R71 G72 R94 P95 G96 G97 R100 R103 P113 R127 N130 Q134 Q142	R2 R4 R6 L7 W10 N11 W17 Q18 R20 V21 L41 A42 K45 R49 Y50 D52 S67 R70 G71 R93 P94 G95 G96 R99 R102 P112 R126 N129 Q133 Q141

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0015934	large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7pkt, PDBe:7pkt, PDBj:7pkt
PDBsum	7pkt
PubMed	34887394
UniProt	A0A2K3DXS2

[Back to BioLiP]