Structure of PDB 7pjs Chain m

Receptor sequence

>7pjsm (length=114) Species: 562 (Escherichia coli) [Search protein sequence]

ARIAGINIPDHKHAVIALTSIYGVGKTRSKAILAAAGIAEDVKISELSEG
QIDTLRDEVAKFVVEGDLRREISMSIKRLMDLGCYRGLRHRRGLPVRGQR
TKTNARTRKGPRKP

3D structure

PDB

7pjs Structural mechanism of GTPase-powered ribosome-tRNA movement

Chain

Resolution

2.35 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	m	M80 R91 R92	M80 R91 R92
BS02	rna	m	K12 H13 I16 Y22 G23 V24 G25 T27 R28 S75 Y85 R86 R89 H90 L94 P95 V96 R97 Q99 R100 T101 K102 T103 N104 A105 R106 T107 R108 K109 R112 K113 P114	K12 H13 I16 Y22 G23 V24 G25 T27 R28 S75 Y85 R86 R89 H90 L94 P95 V96 R97 Q99 R100 T101 K102 T103 N104 A105 R106 T107 R108 K109 R112 K113 P114
BS03	MG	m	T19 I21 V24	T19 I21 V24

Gene Ontology

	Molecular Function
GO:0000049	tRNA binding
GO:0003676	nucleic acid binding
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0000028	ribosomal small subunit assembly
GO:0006412	translation

	Cellular Component
GO:0005829	cytosol
GO:0005840	ribosome
GO:0015935	small ribosomal subunit
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links