Structure of PDB 7pib Chain m

Receptor sequence

>7pibm (length=119) Species: 272634 (Mycoplasmoides pneumoniae M129)

SYINKPGKTSAWRVMTVRQQVSAVLAYGKIETTLKKAKNTQKRLDKLITL
AKVDNFNNRRQVKKWLLNTNLFDVDQLMDHLFSKVAPKYEKTPGGYSRVL
KLGPRRGDATEMAILQLTD

3D structure

• PDB: 7pib Visualizing translation dynamics at atomic detail inside a bacterial cell.
• Chain: m
• Resolution: 4.7 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	m	S2 Y3 I4 N5 K6 K9 W13 V15 M16 Q20 Y28 I31 E32 T33 K36 K37 K39 N40 K43 R44 D46 T50 R60 R61 K64 K65 T70 N71 P94 G95 G96 K102 R106 R107 D109 A110 T111	S1 Y2 I3 N4 K5 K8 W12 V14 M15 Q19 Y27 I30 E31 T32 K35 K36 K38 N39 K42 R43 D45 T49 R59 R60 K63 K64 T69 N70 P93 G94 G95 K101 R105 R106 D108 A109 T110

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7pib, PDBe:7pib, PDBj:7pib
• PDBsum: 7pib
• PubMed: 36171285
• UniProt: Q59547|RL17_MYCPN Large ribosomal subunit protein bL17 (Gene Name=rplQ)