Structure of PDB 7oi8 Chain m

Receptor sequence
>7oi8m (length=45) Species: 9606 (Homo sapiens) [Search protein sequence]
DSSRASLTRVHRQAYARLYPVLLVKQDGSTIHIRYREPRRMLAMP
3D structure
PDB7oi8 A distinct assembly pathway of the human 39S late pre-mitoribosome.
Chainm
Resolution3.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna m H44 R45 H11 R12
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
GO:0032543 mitochondrial translation
Cellular Component
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0005762 mitochondrial large ribosomal subunit
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7oi8, PDBe:7oi8, PDBj:7oi8
PDBsum7oi8
PubMed34315873
UniProtQ7Z7F7|RM55_HUMAN Large ribosomal subunit protein mL55 (Gene Name=MRPL55)

[Back to BioLiP]