Structure of PDB 7m4z Chain m

Receptor sequence
>7m4zm (length=115) Species: 480119 (Acinetobacter baumannii AB0057) [Search protein sequence]
ARIAGVNIPDNKHAVISLTYIFGIGRHTAKNILAAVGITETTKIRELDDA
QLDAIRAEVAKVPTEGDLRREISMNIKRLMDLGCYRGLRHRRSLPVRGQR
TKTNARTRKGPRKPI
3D structure
PDB7m4z Cryo-EM Determination of Eravacycline-Bound Structures of the Ribosome and the Multidrug Efflux Pump AdeJ of Acinetobacter baumannii.
Chainm
Resolution2.92 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna m K13 I17 F23 G24 I25 G26 T29 N76 Y86 R87 R90 H91 P96 V97 R98 Q100 R101 T102 K103 N105 A106 R107 T108 R109 K110 R113 K114 I116 K12 I16 F22 G23 I24 G25 T28 N75 Y85 R86 R89 H90 P95 V96 R97 Q99 R100 T101 K102 N104 A105 R106 T107 R108 K109 R112 K113 I115
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005829 cytosol
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7m4z, PDBe:7m4z, PDBj:7m4z
PDBsum7m4z
PubMed34044590
UniProtB7IA17|RS13_ACIB5 Small ribosomal subunit protein uS13 (Gene Name=rpsM)

[Back to BioLiP]