Structure of PDB 7bt6 Chain m

Receptor sequence

>7bt6m (length=452) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]

DGNLRVKGENFYRDSKRVKFLNMYTSGKEIRNKKGNLIRAASFQDSTIPD
ARVQPDRRWFGNTRVISQDALQHFRSALGETQKDTYQVLLRRNKLPMSLL
EEKDADESPKARILDTESYADAFGPKAQRKRPRLAASNLEDLVKATNEDI
TKYEEKQVLDATLGGNQEDKENGWTSAAKEAIFSKGQSKRIWNELYKVID
SSDVVIHVLDARDPLGTRCKSVEEYMKKETPHKHLIYVLNKCDLVPTWVA
AAWVKHLSKERPTLAFHASITNSFGKGSLIQLLRQFSQLHTDRKQISVGF
IGYPNTGKSSIINTLRKKKVCQVAPIPGETKVWQYITLMKRIFLIDCPGI
VPPSSKDSEEDILFRGVVRVEHVTHPEQYIPGVLKRCQVKHLERTYEISG
WKDATEFIEILARKQGRLLKGGEPDESGVSKQILNDFNRGKIPWFVLPPE
KE

3D structure

PDB

7bt6 Structural insights into assembly of the ribosomal nascent polypeptide exit tunnel.

Chain

Resolution

3.12 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	m	N21 F29 Y30 R31 K34 R35 F38 K51 I56 R57 R75 R76 R82 Y104 R109 K112 K128 R130 I131 L132 Q146 K148 R149 K205 S208 K209 R210 Y216 S241 Y245 L264 W268 A271 K275 S278 T291 N292 I300 R304 Q308 D312 R313 K314 V340 P345 G348 Y355 T357 M359 P373 S374 V387 R389 Q408 K410 Q435 R437 K440 G441 R459 F465 P469 E470 K471	N3 F11 Y12 R13 K16 R17 F20 K33 I38 R39 R57 R58 R64 Y86 R91 K94 K110 R112 I113 L114 Q128 K130 R131 K185 S188 K189 R190 Y196 S221 Y225 L244 W248 A251 K255 S258 T271 N272 I280 R284 Q288 D292 R293 K294 V320 P325 G328 Y335 T337 M339 P353 S354 V367 R369 Q388 K390 Q415 R417 K420 G421 R439 F445 P449 E450 K451
BS02	GTP	m	K261 L264 A288 N325 G327 K328 S329 S330 P345 T350	K241 L244 A268 N305 G307 K308 S309 S310 P325 T330

Gene Ontology

	Molecular Function
GO:0003924	GTPase activity
GO:0005515	protein binding
GO:0005525	GTP binding
GO:0070180	large ribosomal subunit rRNA binding

	Biological Process
GO:0000055	ribosomal large subunit export from nucleus
GO:0042254	ribosome biogenesis
GO:2000200	regulation of ribosomal subunit export from nucleus

	Cellular Component
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005730	nucleolus
GO:0030687	preribosome, large subunit precursor

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7bt6, PDBe:7bt6, PDBj:7bt6
PDBsum	7bt6
PubMed	33037216
UniProt	P53742\|NOG2_YEAST Nucleolar GTP-binding protein 2 (Gene Name=NOG2)

[Back to BioLiP]