Structure of PDB 6ypu Chain m

Receptor sequence
>6ypum (length=122) Species: 575584 (Acinetobacter baumannii ATCC 19606 = CIP 70.34 = JCM 6841) [Search protein sequence]
ATTNQLIRKGRTTLVEKSKVPALKACPQRRGVCTRVYTTTPKKPNSAMRK
VCRVRLTSGFEVSSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGS
LDCAGVKDRNQSRSKYGAKRPK
3D structure
PDB6ypu Structure of the 70S Ribosome from the Human Pathogen Acinetobacter baumannii in Complex with Clinically Relevant Antibiotics.
Chainm
Resolution2.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna m A2 N5 Q6 R9 R12 T13 K18 C27 P28 Q29 R31 N46 S47 A48 R50 T58 G68 G69 E70 R83 G84 K88 R110 N111 Q112 S113 R114 S115 K116 R121 A1 N4 Q5 R8 R11 T12 K17 C26 P27 Q28 R30 N45 S46 A47 R49 T57 G67 G68 E69 R82 G83 K87 R109 N110 Q111 S112 R113 S114 K115 R120
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6ypu, PDBe:6ypu, PDBj:6ypu
PDBsum6ypu
PubMed32857965
UniProtD0C9P6

[Back to BioLiP]