Structure of PDB 6ylh Chain m

Receptor sequence

>6ylhm (length=439) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]

TGKKEKSRRIREGRVKGENFYRDSKRVKFLNMYTSGKEIRNKKGNLIRAA
SFQDSTIPDARVQPDRRWFGNTRVISQDALQHFRSALGETQKDTYQVLLR
RNKLPMSLLARILDTESYADAFGPKAQRKRPRLAASNLEDLVKATNEDIT
KYEEKQVLDAENGWTSAAKEAIFSKGQSKRIWNELYKVIDSSDVVIHVLD
ARDPLGTRCKSVEEYMKKETPHKHLIYVLNKCDLVPTWVAAAWVKHLSKE
RPTLAFHASITNSFGKGSLIQLLRQFSQLHTDRKQISVGFIGYPNTGKSS
IINTLRKKKVCQVAPIPGETKVWQYITLMKRIFLIDCPGIVPPSSKDSEE
DILFRGVVRVEHVTHPEQYIPGVLKRCQVKHLERTYEISGWKDATEFIEI
LARKQGRLLKGGEPDESGVSKQILNDFNRGKIPWFVLPP

3D structure

PDB

6ylh Construction of the Central Protuberance and L1 Stalk during 60S Subunit Biogenesis.

Chain

Resolution

3.1 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	m	T3 G4 K5 K6 E7 R13 K25 F29 Y30 R31 R35 N50 K51 R130 L132 K144 Q146 K148 R149 I202 K205 S208 R210 I211 W212 N213 Y216 S241 C262 D263 H287 T291 N292 S293 F294 K296 G297 Q301 R304 K338 K339 V340 P345 Y355 T357 M359 K360 R361 P373 S374 V387 R389 E391 H392 Q435 R437 K440 G441 Q452 R459 G460 K461	T1 G2 K3 K4 E5 R11 K16 F20 Y21 R22 R26 N41 K42 R111 L113 K125 Q127 K129 R130 I172 K175 S178 R180 I181 W182 N183 Y186 S211 C232 D233 H257 T261 N262 S263 F264 K266 G267 Q271 R274 K308 K309 V310 P315 Y325 T327 M329 K330 R331 P343 S344 V357 R359 E361 H362 Q405 R407 K410 G411 Q422 R429 G430 K431
BS02	GTP	m	N260 K261 D263 H287 A288 N325 G327 K328 S329 S330 V343 A344 P345 T350	N230 K231 D233 H257 A258 N295 G297 K298 S299 S300 V313 A314 P315 T320

Gene Ontology

	Molecular Function
GO:0003924	GTPase activity
GO:0005515	protein binding
GO:0005525	GTP binding
GO:0070180	large ribosomal subunit rRNA binding

	Biological Process
GO:0000055	ribosomal large subunit export from nucleus
GO:0042254	ribosome biogenesis
GO:2000200	regulation of ribosomal subunit export from nucleus

	Cellular Component
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005730	nucleolus
GO:0030687	preribosome, large subunit precursor

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6ylh, PDBe:6ylh, PDBj:6ylh
PDBsum	6ylh
PubMed	32668200
UniProt	P53742\|NOG2_YEAST Nucleolar GTP-binding protein 2 (Gene Name=NOG2)

[Back to BioLiP]