Structure of PDB 6s13 Chain m

Receptor sequence

>6s13m (length=104) Species: 1280 (Staphylococcus aureus) [Search protein sequence]

VDIPREKRVVISLTYIYGIGTSTAQKILEEANVSADTRVKDLTDDELGRI
REVVDGYKVEGDLRRETNLNIKRLMEISSYRGIRHRRGLPVRGQKTKNNA
RTRK

3D structure

PDB

6s13 Exit tunnel modulation as resistance mechanism of S. aureus erythromycin resistant mutant.

Chain

Resolution

3.58 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	m	R14 V16 T20 Y21 I22 Y23 G24 I25 G26 T27 S28 T29 A30 Q31 K32 E35 T73 Y86 R87 G88 R90 H91 G94 P96 R98 G99 Q100 K101 T102 K103 N104 N105 A106 R107 T108 R109 K110	R8 V10 T14 Y15 I16 Y17 G18 I19 G20 T21 S22 T23 A24 Q25 K26 E29 T67 Y80 R81 G82 R84 H85 G88 P90 R92 G93 Q94 K95 T96 K97 N98 N99 A100 R101 T102 R103 K104

Gene Ontology

	Molecular Function
GO:0003676	nucleic acid binding
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome

External links