Structure of PDB 6n8j Chain m

Receptor sequence

>6n8jm (length=378) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]

GTGKKEKSRRIREGRVKGENFYRDSKRVKFLNMYTSGKEIRRAASFQDST
IPDARVQPDRRWFGNTRVISQDALARILDTESYADAFGPKAQRKRPLEDL
VKATNEDITKYEEKQVSKGQSKRIWNELYKVIDSSDVVIHVLDARDPLGT
RCKSVEEYMKKETPHKHLIYVLNKCDLVPTWVAAAWVKHLSKERPTLAFH
ASITNSFGKGSLIQLLRQFSQLHTQISVGFIGYPNTGKSSIINTLRKKKV
CQVAPIPGETKVWQYITLMKRIFLIDCPGIVPPSSKDSEEDILFRGVVRV
EHVTHPEQYIPGVLKRCQVKHLERTYEISGWKDATEFIEILARKQGRLLK
GGEPDESGVSKQILNDFNRGKIPWFVLP

3D structure

PDB

6n8j Tightly-orchestrated rearrangements govern catalytic center assembly of the ribosome.

Chain

Resolution

3.5 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	m	G2 T3 G4 K5 K6 E7 R10 K25 F29 Y30 R31 R35 R57 A58 D63 T65 I66 D68 R130 L132 K144 S208 W212 Y216 Y245 E249 I290 T291 K296 L335 R336 K337 K338 K339 V340 P345 Y355 T357 L358 M359 K360 P373 S374 R389 E391 Q435 R437 L439 K440 Q452	G1 T2 G3 K4 K5 E6 R9 K17 F21 Y22 R23 R27 R42 A43 D48 T50 I51 D53 R76 L78 K90 S121 W125 Y129 Y158 E162 I203 T204 K209 L245 R246 K247 K248 K249 V250 P255 Y265 T267 L268 M269 K270 P283 S284 R299 E301 Q345 R347 L349 K350 Q362
BS02	GTP	m	K261 H287 A288 N325 K328 S329 V343 A344 E349 T350	K174 H200 A201 N235 K238 S239 V253 A254 E259 T260

Gene Ontology

	Molecular Function
GO:0003924	GTPase activity
GO:0005515	protein binding
GO:0005525	GTP binding
GO:0070180	large ribosomal subunit rRNA binding

	Biological Process
GO:0000055	ribosomal large subunit export from nucleus
GO:0042254	ribosome biogenesis
GO:2000200	regulation of ribosomal subunit export from nucleus

	Cellular Component
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005730	nucleolus
GO:0030687	preribosome, large subunit precursor

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6n8j, PDBe:6n8j, PDBj:6n8j
PDBsum	6n8j
PubMed	30814529
UniProt	P53742\|NOG2_YEAST Nucleolar GTP-binding protein 2 (Gene Name=NOG2)

[Back to BioLiP]