Structure of PDB 6hu9 Chain m

Receptor sequence

>6hu9m (length=534) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]

MVQRWLYSTNAKDIAVLYFMLAIFSGMAGTAMSLIIRLELAAPGSQYLHG
NSQLFNVLVVGHAVLMIFFLVMPALIGGFGNYLLPLMIGATDTAFPRINN
IAFWVLPMGLVCLVTSTLVESGAGTGWTVYPPLSSIQAHSGPSVDLAIFA
LHLTSISSLLGAINFIVTTLNMRTNGMTMHKLPLFVWSIFITAFLLLLSL
PVLSAGITMLLLDRNFNTSFFEVSGGGDPILYEHLFWFFGHPEVYILIIP
GFGIISHVVSTYSKKPVFGEISMVYAMASIGLLGFLVWSHHMYIVGLDAD
TRAYFTSATMIIAIPTGIKIFSWLATIHGGSIRLATPMLYAIAFLFLFTM
GGLTGVALANASLDVAFHDTYYVVGHFHYVLSMGAIFSLFAGYYYWSPQI
LGLNYNEKLAQIQFWLIFIGANVIFFPMHFLGINGMPRRIPDYPDAFAGW
NYVASIGSFIATLSLFLFIYILYDQLVNGLNNKVNNKSVIYNKAPDFVES
NTIFNLNTVKSSSIEFLLTSPPAVHSFNTPAVQS

3D structure

PDB

6hu9 Structure of yeast cytochrome c oxidase in a supercomplex with cytochrome bc1.

Chain

Resolution

3.35 Å

3D
structure

Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Catalytic site (original residue number in PDB)	H62 D92 W127 S157 S158 H241 E243 Y245 S256 H290 H291 T316 K319 R438
Catalytic site (residue number reindexed from 1)	H62 D92 W127 S157 S158 H241 E243 Y245 S256 H290 H291 T316 K319 R438
Enzyme Commision number	7.1.1.9: cytochrome-c oxidase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	CU	m	H241 H290 H291	H241 H290 H291
BS02	HEA	m	F19 I23 G26 T30 S33 R37 V59 H62 A63 M66 W127 Y371 F377 H378 L381 I386 L389 F390 F425 M428 R439 L465	F19 I23 G26 T30 S33 R37 V59 H62 A63 M66 W127 Y371 F377 H378 L381 I386 L389 F390 F425 M428 R439 L465
BS03	HEA	m	W127 W237 V244 Y245 I248 H290 H291 T309 A313 T316 G317 G352 G355 V356 L358 D364 H368 H376 F377 V380 L381 R438	W127 W237 V244 Y245 I248 H290 H291 T309 A313 T316 G317 G352 G355 V356 L358 D364 H368 H376 F377 V380 L381 R438
BS04	CA	m	E39 A42 P43 G44	E39 A42 P43 G44
BS05	MG	m	H368 D369	H368 D369

Gene Ontology

	Molecular Function
GO:0004129	cytochrome-c oxidase activity
GO:0005515	protein binding
GO:0020037	heme binding
GO:0046872	metal ion binding

	Biological Process
GO:0006119	oxidative phosphorylation
GO:0006123	mitochondrial electron transport, cytochrome c to oxygen
GO:0009060	aerobic respiration
GO:0015990	electron transport coupled proton transport
GO:0045333	cellular respiration

	Cellular Component
GO:0005739	mitochondrion
GO:0005743	mitochondrial inner membrane
GO:0016020	membrane
GO:0031966	mitochondrial membrane
GO:0045277	respiratory chain complex IV

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6hu9, PDBe:6hu9, PDBj:6hu9
PDBsum	6hu9
PubMed	30598554
UniProt	P00401\|COX1_YEAST Cytochrome c oxidase subunit 1 (Gene Name=COX1)

[Back to BioLiP]