Structure of PDB 6gxo Chain m
Receptor sequence
| >6gxom (length=114) Species: 562 (Escherichia coli) [Search protein sequence] |
| ARIAGINIPDHKHAVIALTSIYGVGKTRSKAILAAAGIAEDVKISELSEG QIDTLRDEVAKFVVEGDLRREISMSIKRLMDLGCYRGLRHRRGLPVRGQR TKTNARTRKGPRKP |
3D structure
| PDB | 6gxo Visualization of translation termination intermediates trapped by the Apidaecin 137 peptide during RF3-mediated recycling of RF1. | ||
| Chain | m | ||
| Resolution | 3.9 Å | ||
| 3D structure |
|
Enzymatic activity
| Enzyme Commision number | ? |
Interaction with ligand
| Site # |
Ligand | Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
|---|---|---|---|---|---|
| BS01 | rna | m | H13 I16 Y22 G23 V24 G25 T27 R28 F62 R86 R89 H90 L94 V96 R97 Q99 R100 T101 K102 T103 N104 A105 R106 T107 K109 R112 P114 | H13 I16 Y22 G23 V24 G25 T27 R28 F62 R86 R89 H90 L94 V96 R97 Q99 R100 T101 K102 T103 N104 A105 R106 T107 K109 R112 P114 |
Gene Ontology
| Molecular Function | |
|---|---|
| GO:0000049 | tRNA binding |
| GO:0003676 | nucleic acid binding |
| GO:0003723 | RNA binding |
| GO:0003735 | structural constituent of ribosome |
| GO:0005515 | protein binding |
| GO:0019843 | rRNA binding |
