Structure of PDB 6gq1 Chain m

Receptor sequence
>6gq1m (length=52) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
IIEPSLKALASKYNCDKSVCRKCYARLPPRATNCRKRKCGHTNQLRPKKK
LK
3D structure
PDB6gq1 Structural Insights into the Role of Diphthamide on Elongation Factor 2 in mRNA Reading-Frame Maintenance.
Chainm
Resolution4.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna m V95 R97 Y100 R102 P104 R111 K112 R113 K114 H117 R122 K124 K125 V19 R21 Y24 R26 P28 R35 K36 R37 K38 H41 R46 K48 K49
BS02 ZN m C110 R111 K112 C34 R35 K36
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6gq1, PDBe:6gq1, PDBj:6gq1
PDBsum6gq1
PubMed29886014
UniProtP0CH08|RL40A_YEAST Ubiquitin-ribosomal protein eL40A fusion protein (Gene Name=RPL40A)

[Back to BioLiP]