Structure of PDB 5x8p Chain m

Receptor sequence

>5x8pm (length=110) Species: 3562 (Spinacia oleracea)

PKKGGIGHGGLQIECIRIGGVEIPNHKRVEYSLQYIHGIGRSRSRQILLD
LNFDNKVTKDLSEEEVIILRKEKRFNRVAIERLKEIRCYRGIRHKLGLPV
RGQRTKNNCR

3D structure

• PDB: 5x8p Unique localization of the plastid-specific ribosomal proteins in the chloroplast ribosome small subunit provides mechanistic insights into the chloroplastic translation
• Chain: m
• Resolution: 3.4 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	m	C119 R121 G122 I123	C88 R90 G91 I92
BS02	rna	m	Q43 I44 I47 I54 P55 N56 H57 K58 R72 E116 Y120 R121 H125 K126 L127 G128 L129 P130 V131 R132 G133 Q134 R135 K137 N138	Q12 I13 I16 I23 P24 N25 H26 K27 R41 E85 Y89 R90 H94 K95 L96 G97 L98 P99 V100 R101 G102 Q103 R104 K106 N107

Gene Ontology

Molecular Function

• GO:0003676 nucleic acid binding
• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome

External links

• PDB: RCSB:5x8p, PDBe:5x8p, PDBj:5x8p
• PDBsum: 5x8p
• PubMed: 28582576
• UniProt: P82163|RR13_SPIOL Small ribosomal subunit protein uS13c (Gene Name=RPS13)