Structure of PDB 5t5h Chain m

Receptor sequence
>5t5hm (length=95) Species: 5693 (Trypanosoma cruzi) [Search protein sequence]
PAPRTGIIAGFNKGHKTTRRARAPSSNDRYALPHKKLRAVKAIITDLVGL
SPMERRVQELLRVGKDKRALKFCKKRLGNFKAAKKRRAKMEEALR
3D structure
PDB5t5h Structure and assembly model for the Trypanosoma cruzi 60S ribosomal subunit.
Chainm
Resolution2.54 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna m R17 G27 H28 T30 N40 R42 Y43 P46 H47 K49 L50 R51 K54 M66 R89 L90 G91 F93 K94 K97 K98 R99 R4 G14 H15 T17 N27 R29 Y30 P33 H34 K36 L37 R38 K41 M53 R76 L77 G78 F80 K81 K84 K85 R86
BS02 rna m R69 K78 K80 R81 K84 K87 K88 F93 R56 K65 K67 R68 K71 K74 K75 F80
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5t5h, PDBe:5t5h, PDBj:5t5h
PDBsum5t5h
PubMed27791004
UniProtV5BDJ2

[Back to BioLiP]