Structure of PDB 3jbu Chain m

Receptor sequence
>3jbum (length=135) Species: 83333 (Escherichia coli K-12) [Search protein sequence]
MLQPKRTKFRKMHKGRNRGLAQGTDVSFGSFGLKAVGRGRLTARQIEAAR
RAMTRAVKRQGKIWIRVFPDKPITEKPLAVMGKGKGNVEYWVALIQPGKV
LYEMDGVPEELAREAFKLAAAKLPIKTTFVTKTVM
3D structure
PDB3jbu Mechanisms of ribosome stalling by SecM at multiple elongation steps
Chainm
Resolution3.64 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna m R18 R38 R18 R38
BS02 rna m K5 K8 F9 H13 K14 R16 Q22 F28 R40 R44 K62 R66 F68 D70 K76 L78 M82 G83 K84 G85 K86 A122 K123 P125 K127 K5 K8 F9 H13 K14 R16 Q22 F28 R40 R44 K62 R66 F68 D70 K76 L78 M81 G82 K83 G84 K85 A121 K122 P124 K126
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3jbu, PDBe:3jbu, PDBj:3jbu
PDBsum3jbu
PubMed26670735
UniProtP0ADY7|RL16_ECOLI Large ribosomal subunit protein uL16 (Gene Name=rplP)

[Back to BioLiP]