Structure of PDB 5dge Chain l5

Receptor sequence

>5dgel5 (length=294) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]

QKDAKSSAYSSRFQTPFRRRREGKTDYYQRKRLVTQHKAKYNTPKYRLVV
RFTNKDIICQIISSTITGDVVLAAAYSHELPRYGITHGLTNWAAAYATGL
LIARRTLQKLGLDETYKGVEEVEGEYELTEAVEDGPRPFKVFLDIGLQRT
TTGARVFGALKGASDGGLYVPHSENRFPGWDFETEEIDPELLRSYIFGGH
VSQYMEELADDDEERFSELFKGYLADDIDADSLEDIYTSAHEAIRADPAF
KPTEKKFTKEQYAAESKKYRQTKLSKEERAARVAAKIAALAGQQ

3D structure

PDB

5dge Coping with proline stalling: structural basis of hypusine-induced protein synthesis by the eukaryotic ribosome

Chain

Resolution

3.45 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	l5	K8 Y12 R15 F16 Q17 R23 G26 T28 Y31 Q32 R35 L36 K43 Y44 K48 R140 P141 F142 F145 L146 I148 T153 H175 S176 N178 R179	K5 Y9 R12 F13 Q14 R20 G23 T25 Y28 Q29 R32 L33 K40 Y41 K45 R137 P138 F139 F142 L143 I145 T150 H172 S173 N175 R176
BS02	rna	l5	K8 S10 S13 S14 F16 T18 F20 R21 R22 R24 T28 Y30 R33 R50 R54 T56 N57 K58 Q63 I65 I69 T70 D72 V74 Y79 G91 N94 Q151 T154 T155 G156 R158 Y198 Y207 E221 L222 K224 T256 K259 F260 K262 Y265 A266 E268 S269 K270 Y272 Q274 K276 L277 K279 R282 R285	K5 S7 S10 S11 F13 T15 F17 R18 R19 R21 T25 Y27 R30 R47 R51 T53 N54 K55 Q60 I62 I66 T67 D69 V71 Y76 G88 N91 Q148 T151 T152 G153 R155 Y195 Y204 E218 L219 K221 T253 K256 F257 K259 Y262 A263 E265 S266 K267 Y269 Q271 K273 L274 K276 R279 R282
BS03	OHX	l5	E209 D234	E206 D231
BS04	OHX	l5	A292 A294 G295 Q297	A289 A291 G292 Q294

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0005515	protein binding
GO:0008097	5S rRNA binding
GO:0019843	rRNA binding

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005634	nucleus
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5dge, PDBe:5dge, PDBj:5dge
PDBsum	5dge
PubMed
UniProt	P26321\|RL5_YEAST Large ribosomal subunit protein uL18 (Gene Name=RPL5)

[Back to BioLiP]