Structure of PDB 5dc3 Chain l5

Receptor sequence

>5dc3l5 (length=294) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]

QKDAKSSAYSSRFQTPFRRRREGKTDYYQRKRLVTQHKAKYNTPKYRLVV
RFTNKDIICQIISSTITGDVVLAAAYSHELPRYGITHGLTNWAAAYATGL
LIARRTLQKLGLDETYKGVEEVEGEYELTEAVEDGPRPFKVFLDIGLQRT
TTGARVFGALKGASDGGLYVPHSENRFPGWDFETEEIDPELLRSYIFGGH
VSQYMEELADDDEERFSELFKGYLADDIDADSLEDIYTSAHEAIRADPAF
KPTEKKFTKEQYAAESKKYRQTKLSKEERAARVAAKIAALAGQQ

3D structure

PDB

5dc3 Crystal Structure of Hypusine-Containing Translation Factor eIF5A Bound to a Rotated Eukaryotic Ribosome.

Chain

Resolution

3.25 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	l5	D6 K8 Y12 R15 F16 Q17 P19 R23 T28 D29 Y31 R35 L36 Y44 T46 K48 R140 P141 F142 F145 L146 R152 T153 P174 H175 S176 N178 R179	D3 K5 Y9 R12 F13 Q14 P16 R20 T25 D26 Y28 R32 L33 Y41 T43 K45 R137 P138 F139 F142 L143 R149 T150 P171 H172 S173 N175 R176
BS02	rna	l5	K8 S10 S13 S14 F16 T18 F20 R21 R22 R24 K27 T28 Y30 R33 R50 R54 T56 N57 Q63 I69 T70 G71 D72 V74 Y79 H90 G91 N94 Q151 R152 T154 T155 G156 A157 R158 Y198 H203 Y207 E221 L222 T256 F260 K262 Y265 A266 E268 S269 K270 Y272 Q274 K276 L277 K279 R282 R285 V286 K289	K5 S7 S10 S11 F13 T15 F17 R18 R19 R21 K24 T25 Y27 R30 R47 R51 T53 N54 Q60 I66 T67 G68 D69 V71 Y76 H87 G88 N91 Q148 R149 T151 T152 G153 A154 R155 Y195 H200 Y204 E218 L219 T253 F257 K259 Y262 A263 E265 S266 K267 Y269 Q271 K273 L274 K276 R279 R282 V283 K286

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0005515	protein binding
GO:0008097	5S rRNA binding
GO:0019843	rRNA binding

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005634	nucleus
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5dc3, PDBe:5dc3, PDBj:5dc3
PDBsum	5dc3
PubMed	27196944
UniProt	P26321\|RL5_YEAST Large ribosomal subunit protein uL18 (Gene Name=RPL5)

[Back to BioLiP]