Structure of PDB 5vyc Chain l4

Receptor sequence
>5vycl4 (length=79) Species: 9606 (Homo sapiens) [Search protein sequence]
QKVTIAKIPRAKKKYVTRVCGLATFEIDLKEAQRFFAQKFSCGASVTGED
EIIIQGDFTDDIIDVIQEKWPEVDDDSIE
3D structure
PDB5vyc Crystal Structure of the Human Ribosome in Complex with DENR-MCT-1.
Chainl4
Resolution6.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna l4 K125 K126 K142 Q145 R146 A149 K151 F152 S153 C154 G155 S157 Q167 K13 K14 K30 Q33 R34 A37 K39 F40 S41 C42 G43 S45 Q55
Gene Ontology
Molecular Function
GO:0003674 molecular_function
GO:0003729 mRNA binding
GO:0003743 translation initiation factor activity
GO:0005515 protein binding
Biological Process
GO:0001731 formation of translation preinitiation complex
GO:0002188 translation reinitiation
GO:0006412 translation
GO:0006413 translational initiation
GO:0032790 ribosome disassembly
GO:0075522 IRES-dependent viral translational initiation
Cellular Component
GO:0005575 cellular_component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5vyc, PDBe:5vyc, PDBj:5vyc
PDBsum5vyc
PubMed28723557
UniProtO43583|DENR_HUMAN Density-regulated protein (Gene Name=DENR)

[Back to BioLiP]