Structure of PDB 6hcm Chain l3

Receptor sequence
>6hcml3 (length=50) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence]
SSHKTFRIKRFLAKKQKQNRPIPQWIWMKTGNKIRYNSKRRHWRRTKLGL
3D structure
PDB6hcm ZNF598 Is a Quality Control Sensor of Collided Ribosomes.
Chainl3
Resolution6.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna l3 S2 S3 H4 K5 K10 L13 K34 R36 S39 K40 R41 H43 W44 K48 S1 S2 H3 K4 K9 L12 K33 R35 S38 K39 R40 H42 W43 K47
BS02 rna l3 K15 R21 I23 W26 M29 I35 K14 R20 I22 W25 M28 I34
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6hcm, PDBe:6hcm, PDBj:6hcm
PDBsum6hcm
PubMed30293783
UniProtG1TTN1

[Back to BioLiP]