Structure of PDB 4u4o Chain l3

Receptor sequence
>4u4ol3 (length=386) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
SHRKYEAPRHGHLGFLPRKRAASIRARVKAFPKDDRSKPVALTSFLGYKA
GMTTIVRDLDRPGSKFHKREVVEAVTVVDTPPVVVVGVVGYVETPRGLRS
LTTVWAEHLSDEVKRRFYKNWYKSKKKAFTKYSAKYAQDGAGIERELARI
KKYASVVRVLVHTQIRKTPLAQKKAHLAEIQLNGGSISEKVDWAREHFEK
TVAVDSVFEQNEMIDAIAVTKGHGFEGVTHRWGTKKLPRKTHRGLRKVAC
IGAWHPAHVMWSVARAGQRGYHSRTSINHKIYRVGKGDDEANGATSFDRT
KKTITPMGGFVHYGEIKNDFIMVKGCIPGNRKRIVTLRKSLYTNTSRKAL
EEVSLKWIDTASKFGKGRFQTPAEKHAFMGTLKKDL
3D structure
PDB4u4o ?
Chainl3
Resolution3.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna l3 S2 H3 R4 K5 Y6 E7 A8 P9 R10 H11 G12 H13 L14 G15 F16 L17 P18 R19 K20 R21 R26 R28 K30 A31 K50 M53 T54 T55 R62 S65 A75 Y92 T95 R97 L99 R100 S101 L102 T103 T104 R116 R117 F118 Y119 K120 N121 Y123 K124 K126 K128 A129 F130 K132 Y133 R150 K153 Y154 R159 Q173 K174 K175 E180 T221 K222 G223 H224 G225 F226 G228 H231 R232 K236 K237 R240 K241 T242 H243 R244 G245 L246 R247 K248 V249 A250 C251 I252 G253 A254 W255 H256 P257 A258 H259 V260 W262 S263 R266 A267 Q269 R270 Y272 S274 R275 T276 I278 N279 G309 V312 H313 G315 K325 C327 I328 P329 G330 R332 K333 R334 Y343 R348 S363 K364 F365 G366 K367 K376 M380 L383 K384 K385 S1 H2 R3 K4 Y5 E6 A7 P8 R9 H10 G11 H12 L13 G14 F15 L16 P17 R18 K19 R20 R25 R27 K29 A30 K49 M52 T53 T54 R61 S64 A74 Y91 T94 R96 L98 R99 S100 L101 T102 T103 R115 R116 F117 Y118 K119 N120 Y122 K123 K125 K127 A128 F129 K131 Y132 R149 K152 Y153 R158 Q172 K173 K174 E179 T220 K221 G222 H223 G224 F225 G227 H230 R231 K235 K236 R239 K240 T241 H242 R243 G244 L245 R246 K247 V248 A249 C250 I251 G252 A253 W254 H255 P256 A257 H258 V259 W261 S262 R265 A266 Q268 R269 Y271 S273 R274 T275 I277 N278 G308 V311 H312 G314 K324 C326 I327 P328 G329 R331 K332 R333 Y342 R347 S362 K363 F364 G365 K366 K375 M379 L382 K383 K384
BS02 OHX l3 K30 A31 K29 A30
BS03 MG l3 T235 K236 T234 K235
BS04 MG l3 T221 G271 T220 G270
BS05 OHX l3 R167 P170 L171 R166 P169 L170
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0002181 cytoplasmic translation
GO:0006364 rRNA processing
GO:0006412 translation
GO:0006414 translational elongation
GO:1990145 maintenance of translational fidelity
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4u4o, PDBe:4u4o, PDBj:4u4o
PDBsum4u4o
PubMed25209664
UniProtP14126|RL3_YEAST Large ribosomal subunit protein uL3 (Gene Name=RPL3)

[Back to BioLiP]