Structure of PDB 7r81 Chain l1

Receptor sequence

>7r81l1 (length=88) Species: 5141 (Neurospora crassa) [Search protein sequence]

TKGTSSFGKRHTKTHGLCRRCGRRSLHNQKKVCASCGYPAAKTRKYNWSE
KAKRRKTTGTGRLRYLSTVSRKFKNGFQTGVPKGSKGP

3D structure

PDB

7r81 Structure of the translating Neurospora ribosome arrested by cycloheximide

Chain

Resolution

2.7 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	l1	T2 K3 G4 T5 S6 S7 F8 G9 K10 R11 H12 T13 K14 T15 H16 R24 R25 H28 Q30 K31 A35 K43 T44 R45 K46 Y47 N48 W49 K52 R55 R56	T1 K2 G3 T4 S5 S6 F7 G8 K9 R10 H11 T12 K13 T14 H15 R23 R24 H27 Q29 K30 A34 K42 T43 R44 K45 Y46 N47 W48 K51 R54 R55
BS02	rna	l1	R21 C22 G23 A42 T59 G62 R63 L64 R65 Y66 L67 V70 R72 F74 K75 N76 Q79 T80 G81 P83 S86 K87	R20 C21 G22 A41 T58 G61 R62 L63 R64 Y65 L66 V69 R71 F73 K74 N75 Q78 T79 G80 P82 S85 K86

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding
GO:0046872	metal ion binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links