Structure of PDB 9brd Chain l

Receptor sequence

>9brdl (length=150) Species: 10116 (Rattus norvegicus) [Search protein sequence]

NNPEYSSFFGVMGASSAMVFSAMGAAYGTAKSGTGIAAMSVMRPELIMKS
IIPVVMAGIIAIYGLVVAVLIANSLTDGITLYRSFLQLGAGLSVGLSGLA
AGFAIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVALILSTK

3D structure

PDB

9brd High-resolution electron cryomicroscopy of V-ATPase in native synaptic vesicles.

Chain

Resolution

3.5 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	CLR	l	I67 V71	I62 V66
BS02	CLR	l	I67 Y68 L150 T154	I62 Y63 L145 T149
BS03	CLR	l	I147 I151	I142 I146

Gene Ontology

	Molecular Function
GO:0031625	ubiquitin protein ligase binding

	Biological Process
GO:0030177	positive regulation of Wnt signaling pathway
GO:0070374	positive regulation of ERK1 and ERK2 cascade
GO:0097401	synaptic vesicle lumen acidification
GO:1902600	proton transmembrane transport
GO:1904093	negative regulation of autophagic cell death

	Cellular Component
GO:0000220	vacuolar proton-transporting V-type ATPase, V0 domain
GO:0008021	synaptic vesicle
GO:0016020	membrane
GO:0030665	clathrin-coated vesicle membrane
GO:0030672	synaptic vesicle membrane
GO:0031410	cytoplasmic vesicle
GO:0033176	proton-transporting V-type ATPase complex
GO:0045202	synapse

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:9brd, PDBe:9brd, PDBj:9brd
PDBsum	9brd
PubMed	38900912
UniProt	P63081\|VATL_RAT V-type proton ATPase 16 kDa proteolipid subunit c (Gene Name=Atp6v0c)

[Back to BioLiP]