Structure of PDB 9b8o Chain l

Receptor sequence
>9b8ol (length=150) Species: 10116 (Rattus norvegicus) [Search protein sequence]
NNPEYSSFFGVMGASSAMVFSAMGAAYGTAKSGTGIAAMSVMRPELIMKS
IIPVVMAGIIAIYGLVVAVLIANSLTDGITLYRSFLQLGAGLSVGLSGLA
AGFAIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVALILSTK
3D structure
PDB9b8o High-resolution electron cryomicroscopy of V-ATPase in native synaptic vesicles.
Chainl
Resolution3.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLR l V71 V74 V66 V69
BS02 CLR l I67 Y68 V71 L75 L150 I62 Y63 V66 L70 L145
BS03 CLR l L143 L150 I151 T154 L138 L145 I146 T149
Gene Ontology
Molecular Function
GO:0031625 ubiquitin protein ligase binding
Biological Process
GO:0030177 positive regulation of Wnt signaling pathway
GO:0070374 positive regulation of ERK1 and ERK2 cascade
GO:0097401 synaptic vesicle lumen acidification
GO:1902600 proton transmembrane transport
GO:1904093 negative regulation of autophagic cell death
Cellular Component
GO:0000220 vacuolar proton-transporting V-type ATPase, V0 domain
GO:0008021 synaptic vesicle
GO:0016020 membrane
GO:0030665 clathrin-coated vesicle membrane
GO:0030672 synaptic vesicle membrane
GO:0031410 cytoplasmic vesicle
GO:0033176 proton-transporting V-type ATPase complex
GO:0045202 synapse

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:9b8o, PDBe:9b8o, PDBj:9b8o
PDBsum9b8o
PubMed38900912
UniProtP63081|VATL_RAT V-type proton ATPase 16 kDa proteolipid subunit c (Gene Name=Atp6v0c)

[Back to BioLiP]