Structure of PDB 8wi7 Chain l

Receptor sequence
>8wi7l (length=115) Species: 246196 (Mycolicibacterium smegmatis MC2 155) [Search protein sequence]
KNVPHGAAHIKSTFNNTIVSITDPQGNVIAWASSGHVGFKGSRKSTPFAA
QLAAENAARKAQEHGVKKVDVFVKGPGSGRETAIRSLQAAGLEVGTISDV
TPQPHNGCRPPKRRR
3D structure
PDB8wi7 Cryo- EM structure of the mycobacterial 70S ribosome in complex with ribosome hibernation promotion factor RafH.
Chainl
Resolution3.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna l H31 N37 N38 G48 N49 V50 W53 S55 G57 H58 G63 S64 K66 K96 P124 Q125 P126 H127 N128 C130 R131 K134 R136 R137 H9 N15 N16 G26 N27 V28 W31 S33 G35 H36 G41 S42 K44 K74 P102 Q103 P104 H105 N106 C108 R109 K112 R114 R115
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8wi7, PDBe:8wi7, PDBj:8wi7
PDBsum8wi7
PubMed38245551
UniProtA0QSL6|RS11_MYCS2 Small ribosomal subunit protein uS11 (Gene Name=rpsK)

[Back to BioLiP]