Structure of PDB 8v9l Chain l

Receptor sequence

>8v9ll (length=122) Species: 246196 (Mycolicibacterium smegmatis MC2 155)

PTIQQLVRKGRRDKIAKVKTAALKGSPQRRGVCTRVYTTTPKKPNSALRK
VARVKLTSQVEVTAYIPGEGHNLQEHSMVLVRGGRVKDLPGVRYKIIRGS
LDTQGVKNRKQARSRYGAKKEK

3D structure

• PDB: 8v9l A new family of bacterial ribosome hibernation factors
• Chain: l
• Resolution: 3.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	l	P2 T3 Q6 R9 R12 R13 D14 K15 S27 P28 Q29 R31 K44 N46 S47 A48 L49 R50 T58 G69 E70 R83 G84 K88 D89 R110 K111 Q112 A113 R114 S115 R116 A119 K121	P1 T2 Q5 R8 R11 R12 D13 K14 S26 P27 Q28 R30 K43 N45 S46 A47 L48 R49 T57 G68 E69 R82 G83 K87 D88 R109 K110 Q111 A112 R113 S114 R115 A118 K120

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8v9l, PDBe:8v9l, PDBj:8v9l
• PDBsum: 8v9l
• PubMed: 38355796
• UniProt: A0QS96|RS12_MYCS2 Small ribosomal subunit protein uS12 (Gene Name=rpsL)