Structure of PDB 8uu9 Chain l

Receptor sequence

>8uu9l (length=135) Species: 1642 (Listeria innocua)

PTINQLVRKPRQSKIKKSTSPALNKGLNSFKRELTDVNSPQKRGVCTRVG
TMTPKKPNSALRKYARVRLSNGIEVTAYIPGIGHNLQEHSVVLIRGGRVK
DLPGVRYHIVRGALDTAGVENRGQSRSKYGTKKPK

3D structure

• PDB: 8uu9 Mechanistic insights into the alternative ribosome recycling by HflXr.
• Chain: l
• Resolution: 3.1 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	l	P2 N5 Q6 R9 R12 Q13 S14 F31 S40 P41 Q42 R44 K57 N59 S60 A61 L62 R63 S71 G97 V100 K101 D102 R123 G124 Q125 S126 R127 S128 K129 T132 K134	P1 N4 Q5 R8 R11 Q12 S13 F30 S39 P40 Q41 R43 K56 N58 S59 A60 L61 R62 S70 G96 V99 K100 D101 R122 G123 Q124 S125 R126 S127 K128 T131 K133

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8uu9, PDBe:8uu9, PDBj:8uu9
• PDBsum: 8uu9
• PubMed: 38407413
• UniProt: A0A660JM56